missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91856

Invitrogen™ Human NUP35 (aa 172-245) Control Fragment Recombinant Protein

Catalog No. RP91856
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91856 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91856 Supplier Invitrogen™ Supplier No. RP91856
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82624 (PA5-82624. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nucleoporin Nup35 or Mitotic phosphoprotein 44 is a nuclear protein known to be present on nuclear pore complex and is tightly associated with the nuclear membrane and lamina. This RNA associated protein belongs to the Nup53 family and has a MPPN (mitotic phosphoprotein N' end) domain. It has a small number of scattered phenylalanine-glycine repeats, but not the large domains seen in other nucleoporins. Though the exact function of NUP35 is yet to be revealed, it may function as a component of the nuclear pore complex (NPC) which are collectively referred to as nucleoporins (NUPs). It also may play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors, and may also play an important part in the association of MAD1, a transcriptional repressor with the NPC. NUP35 is widely expressed in most of the tissues.

Specifications

Accession Number Q8NFH5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 129401
Name Human NUP35 (aa 172-245) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310006I24Rik; 35 kDa nucleoporin; 35 kDa; 5330402E05Rik; Mitotic phosphoprotein 44; Mp44; MP-44; NO44; NP44; Nuclear pore complex protein Nup53; nucleoporin 35; nucleoporin 35 kDa; nucleoporin NUP35; Nucleoporin NUP53; Nup35; NUP53
Common Name NUP35
Gene Symbol NUP35
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCID
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less