missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NUP210L (aa 1646-1727) Control Fragment Recombinant Protein

Catalog No. RP104077
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104077 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104077 Supplier Invitrogen™ Supplier No. RP104077

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64282 (PA5-64282. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nup210L (nuclear pore membrane glycoprotein 210-like) is a 1,888 amino acid single-pass membrane protein that belongs to the NUP210 family. The gene that encodes Nup210L consists of approximately 162,432 bases and maps to human chromosome 1q21.3. Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1.

Specifications

Accession Number Q5VU65
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91181
Name Human NUP210L (aa 1646-1727) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Nuclear pore membrane glycoprotein 210-like; nuclear pore membrane glycoprotein 210-like (LOC91181); Nucleoporin 210 kDa-like; nucleoporin 210 like; nucleoporin 210 kDa like; nucleoporin 210 kDa-like; nucleoporin 210-like; nucleoporin Nup210-like; NUP210L; RGD1310250
Common Name NUP210L
Gene Symbol NUP210L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YVCIIKVRPQSEELLQALSVADTSVYGWATLVSERSKNGMQRILIPFIPAFYINQSELVLSHKQDIGEIRVLGVDRVLRKLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less