missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NUP153 (aa 188-282) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94812
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55721 (PA5-55721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Nuclear pore complexes regulate the transport of macromolecules between the nucleus and cytoplasm. They are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are glycoproteins found in nuclear pores and contain characteristic pentapeptide XFXFG repeats as well as O-linked N-acetylglucosamine residues oriented towards the cytoplasm. The protein encoded by this gene has three distinct domains: a N-terminal region containing a pore targeting and an RNA-binding domain, a central region containing multiple zinc finger motifs, and a C-terminal region containing multiple XFXFG repeats. Alternative splicing results in multiple transcript variants of this gene.Specifications
| P49790 | |
| Blocking Assay, Control | |
| 9972 | |
| 100 μL | |
| 153 kDa nucleoporin; B130015D15Rik; C88147; HNUP153; N153; nuclear pore complex protein hnup153; nuclear pore complex protein Nup153; nucleoporin 153; nucleoporin 153 kD; nucleoporin 153 kDa; nucleoporin 153 kDa L homeolog; nucleoporin Nup153; nucleoporin Nup153 homolog; NUCZINK; nup153; nup153.L; XELAEV_18031694mg | |
| NUP153 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NUP153 (aa 188-282) Control Fragment | |
| RUO | |
| NUP153 | |
| Unconjugated | |
| Recombinant | |
| SSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |