missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91756

Invitrogen™ Human NUDT21 (aa 116-216) Control Fragment Recombinant Protein

Catalog No. RP91756
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91756 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91756 Supplier Invitrogen™ Supplier No. RP91756
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54101 (PA5-54101. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Specifications

Accession Number O43809
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11051
Name Human NUDT21 (aa 116-216) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 25 kDa; 3110048P04Rik; 5730530J16Rik; AU014860; AW549947; CFIM25; cleavage and polyadenylation specific factor 5; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specificity factor 25 kDa subunit; Cleavage and polyadenylation specificity factor subunit 5; cleavage factor Im complex 25 kDa subunit; CPSF 25 kDa subunit; CPSF25; cpsf5; nucleoside diphosphate-linked moiety x motif 21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; nudix hydrolase 21; Nudix motif 21; Nudt21; pre-mRNA cleavage factor Im (25 kD); pre-mRNA cleavage factor Im 25 kDa subunit; Pre-mRNA cleavage factor Im 68 kDa subunit; pre-mRNA cleavage factor Im, 25 kD subunit; similar to cleavage and polyadenylation specific factor 5, 25 kDa; zgc:63966
Common Name NUDT21
Gene Symbol NUDT21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less