missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102741

Invitrogen™ Human Nucleostemin (aa 75-146) Control Fragment Recombinant Protein

Catalog No. RP102741
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102741 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102741 Supplier Invitrogen™ Supplier No. RP102741
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83349 (PA5-83349. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Arylsulfatase F, also known as ARSF, is a 590 amino acid secretory protein that belongs to the sulfatase family of bone and cartilage matrix proteins. Arylsulfatase F uses calcium as a cofactor to catalyze reactions that are important in maintaining correct bone composition. The activity of Arylsulfatase F, unlike that of other family members, such as Arylsulfatase E, is not inhibited by warfarin. The gene encoding Arylsulfatase F maps to human chromosome X, which contains nearly 153 million base pairs and houses over 1,000 genes. In conjunction with chromosome Y, chromosome X is responsible for sex determination. There are a number of conditions related to an abnormal number and combination of sex chromosomes, some of which include Turner's syndrome, color blindness, hemophilia and Duchenne muscular dystrophy.

Specifications

Accession Number Q9BVP2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26354
Name Human Nucleostemin (aa 75-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C77032; E2IG3; E2-induced gene 3 protein; estradiol-induced nucleotide binding protein; G protein nucleolar 3; Gnl3; guanine nucleotide binding protein-like 3 (nucleolar); guanine nucleotide-binding protein-like 3; MGC800; NNP47; novel nucleolar protein 47; Ns; nucleolar GTP-binding protein 3; Nucleostemin
Common Name Nucleostemin
Gene Symbol GNL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less