missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98675

Invitrogen™ Human NUBP2 (aa 29-80) Control Fragment Recombinant Protein

Catalog No. RP98675
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98675 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98675 Supplier Invitrogen™ Supplier No. RP98675

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59684 (PA5-59684. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q9Y5Y2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10101
Name Human NUBP2 (aa 29-80) Control Fragment
Quantity 100 μL
Gene Alias CFD1; Cytosolic Fe-S cluster assembly factor NUBP2; cytosolic Fe-S cluster assembly factor NUBP2 {ECO:0000255; D17Wsu11e; HAMAP-Rule:MF_03039}; homolog of yeast cytosolic Fe-S cluster deficient 1; NBP 2; NBP 2 {ECO:0000255; NUBP1; Nubp2; nucleotide binding protein 2; nucleotide binding protein 2 (MinD homolog, E. coli); Nucleotide-binding protein 2; nucleotide-binding protein 2 {ECO:0000255
Common Name NUBP2
Gene Symbol NUBP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less