missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NT5M (aa 103-166) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100000
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60504 (PA5-60504. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Dephosphorylates specifically the 5' and 2'(3')- phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP.Specifications
| Q9NPB1 | |
| Blocking Assay, Control | |
| 56953 | |
| 100 ÎĽL | |
| 2010013E09Rik; 5' nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase; 5'(3')-deoxyribonucleotidase, mitochondrial; 5',3'-deoxyribonucleotidase, mitochondrial; 5',3'-nucleotidase, mitochondrial; AI846937; Deoxy-5'-nucleotidase 2; DNT2; dNT-2; mdN; mitochondrial 5' nucleotidase; NT5M | |
| NT5M | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NT5M (aa 103-166) Control Fragment | |
| RUO | |
| NT5M | |
| Unconjugated | |
| Recombinant | |
| FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |