missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96576

Invitrogen™ Human NSG2 (aa 111-171) Control Fragment Recombinant Protein

Catalog No. RP96576
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96576 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96576 Supplier Invitrogen™ Supplier No. RP96576
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63263 (PA5-63263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NSG2 is a protein coding gene. Gene ontology (GO) annotation include cytoplasmic vesicle membrane; dendrite; early endosome; early endosome membrane; endosome; Golgi apparatus; Golgi cis cisterna membrane; integral component of membrane; late endosome; lysosomal lumen; multivesicular body membrane; trans-Golgi network membrane.

Specifications

Accession Number Q9Y328
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51617
Name Human NSG2 (aa 111-171) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CALY3; HMP19; HMP19 protein; hypothalamus golgi apparatus expressed 19 kDa protein; neuron specific gene family member 2; Neuronal vesicle trafficking-associated protein 2; neuron-specific protein family member 2; NSG2; p19 protein; protein 8.5; Protein p19
Common Name NSG2
Gene Symbol NSG2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less