missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NRBF2 (aa 4-90) Control Fragment Recombinant Protein

Catalog No. RP101917
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101917 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101917 Supplier Invitrogen™ Supplier No. RP101917
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63733 (PA5-63733. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NRBF2 (nuclear receptor-binding factor 2) modulates transcriptional activation by target nuclear receptors. It is involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). NRBF2 stabilizes the PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3.

Specifications

Accession Number Q96F24
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29982
Name Human NRBF2 (aa 4-90) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Comodulator of PPAR and RXR; comodulator of PPAR and RXR 1; comodulator of PPAR and RXR 2; COPR; COPR1; COPR2; Nrbf2; NRBF-2; nuclear receptor binding factor 2; nuclear receptor binding factor-2; nuclear receptor-binding factor 2
Common Name NRBF2
Gene Symbol Nrbf2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less