missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109691

Invitrogen™ Human NR5A1 (aa 223-272) Control Fragment Recombinant Protein

Catalog No. RP109691
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109691 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109691 Supplier Invitrogen™ Supplier No. RP109691

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139965. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Steroidogenic factor-1 (SF-1) is an orphan nuclear receptor involved in organ development and differentiation of the endocrine system. SF-1 has been shown to be essential for fetal development of the hypothalamus, pituitary gland, gonads, and the adrenal gland. SF-1 has been shown to promote transcriptional activity of many steroidogenic enzymes from the cytochrome P450 family. SF-1 contains two activation function domains, designated AF1 and AF2, common to many nuclear steroid receptors which have been shown to be necessary for interaction with other nuclear receptors as well as coactivators and corepressors including steroid receptor coactivator-1 (SRC-1), glucocorticoid receptor interacting protein 1 (GRIP1), cAMP response element binding protein (CREB) binding protein (CBP) and silencing mediator of retinoid acid and thyroid hormone receptor (SMRT).

Specifications

Accession Number Q13285
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2516
Name Human NR5A1 (aa 223-272) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Ad4BP; Ad4BP/SF-1; adrenal 4 binding protein; Adrenal 4 binding protein (AD4BP); adrenal 4-binding protein; ELP; ELP-3; Embryonal long terminal repeat-binding protein; embryonal LTR-binding protein; FTZ1; FTZF1; Ftz-F1; fushi tarazu 1 factor homolog; fushi tarazu factor homolog 1; Fushi tarazu factor homolog 1 (FTZ1); hSF-1; Nr5a1; nuclear receptor AdBP4; nuclear receptor subfamily 5 group A member 1; Nuclear receptor subfamily 5 group A member 1 (NR5A1); nuclear receptor subfamily 5, group A, member 1; POF7; SF1; SF-1; SPGF8; SRXY3; Steroid hormone receptor Ad4BP; steroid hydroxylase positive regulator; Steroidogenic factor 1; Steroidogenic factor 1 (SF1); steroidogenic factor 1 nuclear receptor; steroidogenic factor-1; STF1; STF-1
Common Name NR5A1
Gene Symbol Nr5a1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less