missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NOTCH3 (aa 1699-1766) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109835
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
NOTCH3 is the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction (with its cell-bound ligands delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human. NOTCH3 functions as a receptor for membrane-bound ligands Jagged1, Jagged2, and Delta1 to regulate cell-fate determination. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).Specifications
| Q9UM47 | |
| Blocking Assay, Control | |
| 4854 | |
| 100 μL | |
| AW229011; CADASIL; CADASIL1; CASIL; hpbk; IMF2; LMNS; N3; Neurogenic locus notch homolog protein 3; notch 3; Notch 3 extracellular truncation; Notch 3 intracellular domain; Notch gene homolog 3; Notch homolog 3; NOTCH3 | |
| Notch3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NOTCH3 (aa 1699-1766) Control Fragment | |
| RUO | |
| NOTCH3 | |
| Unconjugated | |
| Recombinant | |
| QDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAADIRVAPAM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |