missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NOM1 (aa 595-726) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104930
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65678 (PA5-65678. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Proteins that contain MIF4G (middle of eIF4G (MIM 600495)) and/or MA3 domains, such as NOM1, function in protein translation. These domains include binding sites for members of the EIF4A family of ATP-dependent DEAD box RNA helicases (see EIF4A1; MIM 602641) (Simmons et al., 2005 [PubMed 15715967]).[supplied by OMIM, Mar 2008].Specifications
| Q5C9Z4 | |
| Blocking Assay, Control | |
| 64434 | |
| 100 μL | |
| C7orf3; D5Kng1; Gm1040; Nom1; Nucleolar MIF4G domain-containing protein 1; nucleolar protein with MIF4G domain 1; PPP1R113; protein phosphatase 1, regulatory subunit 113; SGD1; SGD1 homolog | |
| NOM1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NOM1 (aa 595-726) Control Fragment | |
| RUO | |
| NOM1 | |
| Unconjugated | |
| Recombinant | |
| VSWDSVLSAEQTGRWWIVGSAWSGAPMIDNSHHTHLQKQLVGTVSSKILELARKQRMNTDIRRNIFCTIMTSEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQEKTYNPFYAFLASKFCEYERRFQMTFQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |