missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104965

Invitrogen™ Human NOC4L (aa 9-101) Control Fragment Recombinant Protein

Catalog No. RP104965
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104965 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104965 Supplier Invitrogen™ Supplier No. RP104965

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65787 (PA5-65787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.

Specifications

Accession Number Q9BVI4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79050
Name Human NOC4L (aa 9-101) Control Fragment
Quantity 100 μL
Gene Alias AI326906; NET49; NOC4; NOC4 protein homolog; NOC4L; NOC4-like protein; nucleolar complex associated 4 homolog; nucleolar complex associated 4 homolog (S. cerevisiae); nucleolar complex protein 4 homolog; Nucleolar complex-associated protein 4-like protein; RGD1310661; UTP19
Common Name NOC4L
Gene Symbol NOC4L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less