missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Ninein (aa 1099-1198) Control Fragment Recombinant Protein

Catalog No. RP107764
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107764 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107764 Supplier Invitrogen™ Supplier No. RP107764
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84846 (PA5-84846. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ninein is a component of subdistal appendages of the mother centriole, localized specifically in the pericentriolar matrix of the centrosome. It may be involved in microtubule minus-end capping, centriole positioning, and protein anchoring. Recent studies have shown that the microtubule nucleation and anchoring at the centrosome are independent processes linked by ninein function. At least five human ninein isoforms with divergent C-terminal domains and two mouse isoforms have been reported. Data indicates that the combined action of domains (C-terminal and N-terminal) might, in the absence of coiled coil region, be sufficient to localize ninein to the mother centriole. Microinjection of antibodies against ninein into metaphase HeLa cells can disrupt the reformation of tubular conformation of proteins within the centrosome following cell division, and consequently lead to dispersal of centrosomal material throughout the cytosol. MTOC (microtubule organizing center) function can be disrupted when anti-ninein antibodies are injected into postmitotic cells. Antibodies against ninein are present in sera from patients with autoimmune diseases that develop autoantibodies to centrosomal proteins.

Specifications

Accession Number Q8N4C6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51199
Name Human Ninein (aa 1099-1198) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110068G20Rik; AI385615; AU024711; glycogen synthase kinase 3 beta-interacting protein; GSK3B-interacting protein; hNinein; KIAA1565; mKIAA1565; Nin; Ninein; ninein (GSK3B interacting protein); ninein centrosomal protein; SCKL7
Common Name Ninein
Gene Symbol NIN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPGLVMSSCLDEPATEFFGNTAEQTEQFLQQNRTKQVEGVTRRHVLSDLEDDEVRDLGSTGTSSVQRQEVKIEESEASVEGFSELENSEETRTESWELKN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less