missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101889

Invitrogen™ Human NGAL (aa 21-157) Control Fragment Recombinant Protein

Catalog No. RP101889
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101889 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101889 Supplier Invitrogen™ Supplier No. RP101889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NGAL (Neutrophil gelatinase-associated lipocalin, lipocalin 2, siderocalin and neutrophil lipocalin) is a 25 kDa glycosylated single chain monomer and member of the lipocalin family of proteins that bind and transport small lipophilic molecules. NGAL is released by activated neutrophils, can form dimers and small amounts of higher oligomers, and complexes with matrix metalloproteinase 9 (MMP-9, gelatinase B). Low level expression of NGAL in a variety of epithelia may be increased in inflammation or cancers. Expression of NGAL in the kidney is dramatically increased by ischemic or nephrotoxic kidney injury.

Specifications

Accession Number P80188
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3934
Name Human NGAL (aa 21-157) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 24p3; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; alpha-2-microglobulin-related protein; Alpha-2 U globulin-related protein; AW212229; HGNC:6526; HNL; LCN2; lipocalin 2; lipocalin 2 (oncogene 24p3); Lipocalin 24p3; Lipocalin2; Lipocalin-2; migration-stimulating factor inhibitor; MSFI; neutrophil gelatinase-associated lipocalin; NGAL; oncogene 24p3; OTTHUMP00000022240; p25; RP23-161B9.11; secreted inducible protein 24; Siderocalin; Siderocalin LCN2; Sip24; SV-40-induced 24P3 protein; uterocalin
Common Name NGAL
Gene Symbol LCN2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less