missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109505

Invitrogen™ Human NeuN (aa 104-137) Control Fragment Recombinant Protein

Catalog No. RP109505
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109505 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109505 Supplier Invitrogen™ Supplier No. RP109505
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fox-3, also known as NEUN, HRNBP3, RBFOX3 (RNA binding protein, fox-1) or Fox-1 homolog C, is a 350 amino acid protein that contains one RRM (RNA recognition motif) domain. Localized to both the nucleus and cytoplasm, Fox-3 is suggested to regulate alternative splicing events. Fox-3 is encoded by a gene located on human chromosome 17, which is comprised over 2.5% of the human genome and encodes over 1,200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Malfunction or loss of p53 expression is associated with malignant cell growth and LiFraumeni syndrome. Like p53, BRCA1 is directly involved in DNA repair, though specifically it is recognized as a genetic determinant of early onset breast cancer and predisposition to cancers of the ovary, colon, prostate gland and fallopian tubes.

Specifications

Accession Number A6NFN3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 146713
Name Human NeuN (aa 104-137) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fo x 1 homolog C; Fox-1 homolog C; FO x 3; FOX-3; FO x 3 NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFO x 3; RFO x 3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3
Common Name NeuN
Gene Symbol RBFOX3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less