missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94159

Invitrogen™ Human NENF (aa 105-164) Control Fragment Recombinant Protein

Catalog No. RP94159
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94159 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94159 Supplier Invitrogen™ Supplier No. RP94159
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55875 (PA5-55875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NENF is a secreted protein that is expressed in neurons but not glial cells of the brain. This protein has neurotrophic activity in primary cultured mouse neurons but not mitogenic activity in primary cultured mouse astrocytes. NENF activated mitogen-activated protein (MAP) and phosphotidylinositol-3 kinase pathways and could be inhibited by pertussis toxin but not receptor tyrosine kinases, suggesting that NENF acts through a Gi/Go-protein-coupled receptor.

Specifications

Accession Number Q9UMX5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29937
Name Human NENF (aa 105-164) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110060M21Rik; cell growth-inhibiting protein 47; cell immortalization-related protein 2; CIR2; NENF; nenf {ECO:0000250; Neudesin; neudesin neurotrophic factor; neuron derived neurotrophic factor; neuron-derived neurotrophic factor; Protein GIG47; SCIRP10; SCIRP10-related protein; secreted protein of unknown function; sp2; SP2 protein; Spinal cord injury related protein 10; spinal cord injury-related protein 10; SPUF; SPUF protein; UniProtKB:Q9CQ45}; wu:fa11a04; wu:fb73f07; zgc:112953; zgc:112953 protein; zgc:152703
Common Name NENF
Gene Symbol NENF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less