missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97225

Invitrogen™ Human NEBL Control Fragment Recombinant Protein

Catalog No. RP97225
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97225 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97225 Supplier Invitrogen™ Supplier No. RP97225

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57915 (PA5-57915. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nebulette encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants.

Specifications

Accession Number O76041
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10529
Name Human NEBL Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200007O21Rik; A630080F05Rik; Actin-binding Z-disk protein; BB140644; D830029A09Rik; LASP2; LIM and SH3 protein 2; LIM zinc-binding domain-containing Nebulette; LIM-nebulette; Lnebl; Nebl; Nebulette
Common Name NEBL
Gene Symbol NEBL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQSWPTLARWLRRVSFSLYKPPIQAAPEPDPGNWAKSPRLSLGPEGITKGKHGFKFQGIKEKFNVSKKVLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less