missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NEBL (aa 200-334) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP90703
Description
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53106 (PA5-53106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Nebulette encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants.Specifications
| O76041 | |
| Blocking Assay, Control | |
| 10529 | |
| 100 μL | |
| 1200007O21Rik; A630080F05Rik; Actin-binding Z-disk protein; BB140644; D830029A09Rik; LASP2; LIM and SH3 protein 2; LIM zinc-binding domain-containing Nebulette; LIM-nebulette; Lnebl; Nebl; Nebulette | |
| NEBL | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NEBL (aa 200-334) Control Fragment | |
| RUO | |
| NEBL | |
| Unconjugated | |
| Recombinant | |
| GQGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEKFDNEMKDKKHHYNPLESASFRQNQLAATLASNVKYKKDIQNMHDPVSDLPNLLFLDHVLKASKMLSGREYKKLFEENKGMYHFDADAVEHLHHKGNAVLQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |