missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NDUFS3 (aa 71-217) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP102229
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82155 (PA5-82155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes one of the iron-sulfur protein components of mitochondrial NADH:ubiquinone oxidoreductase. Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.Specifications
| O75489 | |
| Blocking Assay, Control | |
| 4722 | |
| 100 μL | |
| 0610010M09Rik; CI-30; CI-30 kD; complex I 30 kDa subunit; complex I-30 kD; hypothetical protein LOC550451; NADH dehydrogenase (ubiquinone); NADH dehydrogenase (ubiquinone) Fe-S protein 3; NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30 kDa (NADH-coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; NADH dehydrogenase-ubiquinone 30 kDa subunit; NADH:ubiquinone oxidoreductase core subunit S3; NADH-ubiquinone oxidoreductase 30 kDa subunit; NDUFS3; zgc:112520 | |
| NDUFS3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NDUFS3 (aa 71-217) Control Fragment | |
| RUO | |
| NDUFS3 | |
| Unconjugated | |
| Recombinant | |
| KYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |