missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97870

Invitrogen™ Human NDUFA12 (aa 1-69) Control Fragment Recombinant Protein

Catalog No. RP97870
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97870 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97870 Supplier Invitrogen™ Supplier No. RP97870

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58973 (PA5-58973. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number Q9UI09
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55967
Name Human NDUFA12 (aa 1-69) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 13 kDa differentiation-associated protein; 13 kDa differentiation-associated protein; 2410011G03Rik; AW112974; B17.2; CIB17.2; CI-B17.2; complex I B17.2 subunit; complex I-B17.2; DAP13; DAP13 protein; hypothetical protein LOC613140; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12; NADH:ubiquinone oxidoreductase b17.2 subunit; NADH:ubiquinone oxidoreductase subunit A12; NADH-ubiquinone oxidoreductase subunit B17.2; Ndufa12; RGD1311462; si:dkey-183c16.3; zgc:112053
Common Name NDUFA12
Gene Symbol Ndufa12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less