missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95408

Invitrogen™ Human NCF2 (aa 308-455) Control Fragment Recombinant Protein

Catalog No. RP95408
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95408 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95408 Supplier Invitrogen™ Supplier No. RP95408
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51702 (PA5-51702. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production). Defects in NCF2 are a cause of chronic granulomatous disease autosomal recessive cytochrome-b-positive type 2 (CGD2). Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.

Specifications

Accession Number P19878
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4688
Name Human NCF2 (aa 308-455) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 67 kDa neutrophil oxidase factor; chronic granulomatous disease, autosomal 2; EMBL:FAA00361.1}; FLJ93058; NADPH oxidase activator 2; NADPH oxidase subunit (67 kD); NADPH oxidase subunit (67 kDa); NCF2; NCF-2; ncf2 {ECO:0000312; neutrophil cytosol factor 2; neutrophil cytosolic factor 2; neutrophil cytosolic factor 2 (65 kD, chronic granulomatous disease, autosomal 2); neutrophil NADPH oxidase factor 2; Noxa2; p67phox; p67-phox
Common Name NCF2
Gene Symbol NCF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less