missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93534

Invitrogen™ Human NBR1 (aa 275-372) Control Fragment Recombinant Protein

Catalog No. RP93534
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93534 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93534 Supplier Invitrogen™ Supplier No. RP93534

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54660 (PA5-54660. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene.

Specifications

Accession Number Q14596
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4077
Name Human NBR1 (aa 275-372) Control Fragment
Quantity 100 μL
Gene Alias 1A13B; 1A1-3 B; B-box protein; Ca125; Cell migration-inducing gene 19 protein; IAI3B; KIAA0049; M17S2; Membrane component chromosome 17 surface marker 2; Membrane component chromosome 17 surface marker 2 homolog; membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); MIG19; migration-inducing protein 19; mKIAA0049; Nbr1; NBR1, autophagy cargo receptor; neighbor of Brca1 gene 1; neighbor of BRCA1 gene 1 protein; Next to BRCA1 gene 1 protein; next to the Brca1; ovarian carcinoma antigen CA125; Protein 1A1-3 B; RGD1311421
Common Name NBR1
Gene Symbol NBR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less