missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108996

Invitrogen™ Human NAV3 (aa 1245-1317) Control Fragment Recombinant Protein

Catalog No. RP108996
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108996 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108996 Supplier Invitrogen™ Supplier No. RP108996

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neuron navigator 3 (NAV3), also known as pore membrane and/or filamentinteracting-like protein 1 (POMFIL1), unc-53 homolog 3 (unc53H3) or STEERIN3, is a 2,385 amino acid protein that localizes to the nuclear outer membrane and plays a role in neuron regeneration. Existing as three alternatively spliced isoforms, Neuron navigator 3 is highly expressed in adult and fetal brain and is found at moderate to low levels in ovary, lung, testis, placenta and heart. Neuron navigator 3 is thought be involved in the regulation of IL-2 production and contains one CH (calponin-homology) domain, three N-terminal hydrophobic domains, multiple N-glycosylation sites, three ATP/GTP-binding A motifs (P loops) and several phosphorylation sites.

Specifications

Accession Number Q8IVL0
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 89795
Name Human NAV3 (aa 1245-1317) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4732483H20Rik; 9630020C08Rik; KIAA0938; mKIAA0938; NAV3; Neuron navigator 3; POMFIL1; Pomfil1p; pore membrane and/or filament interacting like protein 1; pore membrane and/or filament-interacting-like protein 1; RGD1306259; steerin 3; STEERIN3; Steerin-3; Unc-53 homolog 3; unc53H3
Common Name NAV3
Gene Symbol NAV3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less