missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NAPSA (aa 238-268) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100024
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60970 (PA5-60970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Napsin 1 is an aspartic protease that is generally expressed in the lung, but also present in kidney and in metastatic carcinomas throughout the body. Napsin 1 processes surfactant protein B in healthy pulmonary and renal tissues, but is abnormally regulated when carcinogenesis occurs. Thus, many researchers have found napsin evaluation to be useful in identifying several cancers, and differentiating primary tumors from metastases. When combined with thyroid transcription factor analysis, napsin can be used as a specific biomarker for differentiation of carcinoma types. Napsin has also been associated with pulmonary alveolar proteinosis as well as in protein catabolism in renal tubules.Specifications
| O96009 | |
| Blocking Assay, Control | |
| 9476 | |
| 100 μL | |
| asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; KDAP-1; kidney-derived aspartic protease-like protein; Nap; NAP1; NAPA; Napsa; napsin A aspartic peptidase; napsin-1; Napsin-A; pronapsin; pronapsin A; SNAPA; TA01/TA02 | |
| NAPSA | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NAPSA (aa 238-268) Control Fragment | |
| RUO | |
| NAPSA | |
| Unconjugated | |
| Recombinant | |
| SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |