missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NAPRT1 (aa 90-161) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93824
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54952 (PA5-54952. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress (Hara et al., 2007).Specifications
| Q6XQN6 | |
| Blocking Assay, Control | |
| 93100 | |
| 100 μL | |
| 9130210N20Rik; FHA-HIT-interacting protein; FHIP; hypothetical protein MGC77870; Naprt; Naprt1; NAPRTase; Nicotinate phosphoribosyltransferase; nicotinate phosphoribosyltransferase domain containing 1; nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinate phosphoribosyltransferase; LOW QUALITY PROTEIN: nicotinate phosphoribosyltransferase; nicotinate phosphoribosyltransferase-like protein; nicotinic acid phosphoribosyltransferase; PP3856; zgc:77870 | |
| NAPRT | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NAPRT1 (aa 90-161) Control Fragment | |
| RUO | |
| NAPRT1 | |
| Unconjugated | |
| Recombinant | |
| PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |