missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103481

Invitrogen™ Human NANOS3 (aa 13-84) Control Fragment Recombinant Protein

Catalog No. RP103481
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103481 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103481 Supplier Invitrogen™ Supplier No. RP103481

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64081 (PA5-64081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nanos is a zinc-finger containing, RNA-binding protein that has been implicated in germ cell development in both invertebrates and vertebrates. In Drosophila, Nanos represses apoptosis during development to ensure proper germ-line development. Unlike Nanos1 whose expression in mice is dispensable, the Nanos2 and Nanos3 proteins are required for germ cell development. Nanos2-null primordial germ cells (PGCs) die only in the male gonads and show no defects in females, while Nanos3-null PGCs are lost during the migration stage regardless of sex. Nanos2 and Nanos3 have distinct expression patterns during embryo development, suggesting that these two proteins do not have redundant functions. However, expression of Nanos2 can at least partially replace Nanos3 function in a Nanos3-null background. Nanos3 expression can not rescue Nanos2-null defects.

Specifications

Accession Number P60323
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 342977
Name Human NANOS3 (aa 13-84) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias nanos C2HC-type zinc finger 3; nanos homolog 3; nanos homolog 3 (Drosophila); NANOS1L; NANOS3; NOS3; NOS-3; ZC2HC12C
Common Name NANOS3
Gene Symbol NANOS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less