missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NAGA (aa 30-161) Control Fragment Recombinant Protein

Catalog No. RP91478
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91478 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91478 Supplier Invitrogen™ Supplier No. RP91478

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51433 (PA5-51433. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAGA (N-acetylgalactosaminidase, alpha), also known as alpha-galactosidase B or GALB, is a 411 lysosomal protein belonging to the glycosyl hydrolase 27 family that may exist as a homodimer and plays a critical role in glycolipid breakdown. NAGA encodes alpha-N-acetylgalactosaminidase, a lysosomal enzyme, which cleaves alpha-N-acetylgalactosaminyl groups from glycoconjugates. Mapping to human chromosome 22q13. 2, NAGA defects are the cause of an autosomal recessive disorder with three phenotypes, known as Schindler disease (types I, II and III) or NAGA deficiency (types I, II and III). Characterized by neurologic manifestations that range in severity, Schindler disease type I is the most severe form, followed by type III, which may have mild-to-moderate effects. Schindler disease type II, also known as Kanzaki disease, is characterized by mild intellectual impairment and angiokeratoma corporis diffusum.

Specifications

Accession Number P17050
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4668
Name Human NAGA (aa 30-161) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Acetylgalactosaminidase, alpha-N- (alpha-galactosidase B); alpha-galactosidase B; Alpha-N-acetylgalactosaminidase; D22S674; EC 3.2.1; EC 3.2.1.49; galactosidasealphaB; galactosidase-alphaB; GALB; N-acetyl galactosaminidase, alpha; N-acetylgalactosaminidase, alpha-; Naga
Common Name NAGA
Gene Symbol NAGA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less