missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NAC1 (aa 275-356) Control Fragment Recombinant Protein

Catalog No. RP93592
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93592 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93592 Supplier Invitrogen™ Supplier No. RP93592

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82753 (PA5-82753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the BTB/POZ family of transcriptional regulators, including BTBD14B, contain a conserved motif in the N-terminal region critical for protein-protein interactions and assembly of high molecular mass complexes (Korutla et al., 2002 [PubMed 11906783]).

Specifications

Accession Number Q96RE7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 112939
Name Human NAC1 (aa 275-356) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010001H03Rik; 4930511N13Rik; BEN domain containing 8; BEND8; BTB (POZ) domain containing 14 B; BTB/POZ domain-containing protein 14 B; Btbd14b; BTBD30; FLJ37383; Nac1; NAC-1; Nacc1; nucleus accumbens associated 1; nucleus accumbens associated 1, BEN and BTB (POZ) domain containing; nucleus accumbens-1; nucleus accumbens-associated protein 1; nucleus accumbens-associated protein 1; LOW QUALITY PROTEIN: nucleus accumbens-associated protein 1; transcriptional repressor NAC1
Common Name NAC1
Gene Symbol NACC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less