missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MYST2 (aa 83-181) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109246
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.Specifications
| O95251 | |
| Blocking Assay, Control | |
| 11143 | |
| 100 μL | |
| EC 2.3.1.48; HBO1; HBOa; histone acetyltransferase binding to ORC1; Histone acetyltransferase KAT7; histone acetyltransferase MYST2; K (lysine) acetyltransferase 7; K(lysine) acetyltransferase 7; Kat7; Lysine acetyltransferase 7; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2; MYST histone acetyltransferase 2; MYST protein 2; MYST2; MYST-2; ZC2HC7 | |
| Kat7 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MYST2 (aa 83-181) Control Fragment | |
| RUO | |
| MYST2 | |
| Unconjugated | |
| Recombinant | |
| QPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |