missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MYOCD (aa 34-97) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109261
Description
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139907 (PA5-139907. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage (myogenesis).Specifications
| Q8IZQ8 | |
| Blocking Assay, Control | |
| 93649 | |
| 100 μL | |
| Basic SAP coiled-coil transcription activator 2; Bsac2; BSAC2A; Mycd; Myocardin; Myocd; SRF cofactor protein; SRF co-factor protein (cardiac and smooth muscle); Srfcp; transcription factor myocardin | |
| Myocd | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MYOCD (aa 34-97) Control Fragment | |
| RUO | |
| MYOCD | |
| Unconjugated | |
| Recombinant | |
| ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |