missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MYLPF (aa 112-143) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108209
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84234 (PA5-84234. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
MYLPF (myosin light chain, phosphorylatable, fast skeletal muscle), also known as fast skeletal myosin light chain 2 or MLC2B, is a 169 amino acid protein that is expressed in fetal and adult skeletal muscle. A calcium binding protein, MYLPF contains three EF hand domains and is encoded by a gene that maps to human chromosome 16p11.2. Chromosome 16 encodes over 900 genes in approximately 90 million base pairs, makes up nearly 3% of human cellular DNA and is associated with a variety of genetic disorders. The GAN gene is located on chromosome 16 and, with mutation, may lead to giant axonal neuropathy, a nervous system disorder characterized by increasing malfunction with growth.Specifications
| Q96A32 | |
| Blocking Assay, Control | |
| 29895 | |
| 100 μL | |
| 2410014J02Rik; DKFZp779C0757; DTNB; fast skeletal myosin light chain 2; G2; HUMMLC2B; MGC13450; MLC2; MLC-2; MLC2B; MLC2F; MRLC2; MYL11; Myl2; MYLPF; Myolc1; myosin light chain; myosin light chain 2; myosin light chain 2 type 2; myosin light chain 2 type I; myosin light chain, phosphorylatable, fast skeletal muscle; Myosin light polypeptide 2 alkali; myosin regulatory light chain 2, skeletal muscle isoform; Myosin regulatory light chain 2, skeletal muscle isoform type 2; myosin, light chain 11, regulatory; Myosin, light polypeptide 2, alkali; Myosin, light polypeptide 2, alkali; ventricular, skeletal, slow; phosphorylatable fast skeletal muscle myosin light chain; Unknown (protein for MGC:143425); ventricular skeletal slow; ventricular, skeletal, slow | |
| MYLPF | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MYLPF (aa 112-143) Control Fragment | |
| RUO | |
| MYLPF | |
| Unconjugated | |
| Recombinant | |
| KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |