missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MYL6B (aa 29-71) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP97888
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58579 (PA5-58579. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue.Specifications
| P14649 | |
| Blocking Assay, Control | |
| 140465 | |
| 100 μL | |
| 5730437E04Rik; BC037527; MLC1SA; MYL6B; myosin alkali light chain 1 slow a; myosin light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; myosin light chain 6 B; myosin, light chain 6 B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6 B; myosin, light polypeptide 6 B, alkali, smooth muscle and non-muscle; sm; smooth muscle and non-muscle myosin alkali light chain 6 B; smooth muscle and nonmuscle myosin light chain alkali 6 B | |
| Myl6b | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MYL6B (aa 29-71) Control Fragment | |
| RUO | |
| MYL6B | |
| Unconjugated | |
| Recombinant | |
| APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |