missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MYL3 (aa 5-69) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91305
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82553 (PA5-82553. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy.Specifications
| P08590 | |
| Blocking Assay, Control | |
| 4634 | |
| 100 μL | |
| Cardiac myosin light chain 1; CMH8; CMLC1; MLC1s; MLC1SB; Mlc1v; MLClV; MLC-lV/sb; MYL3; Mylc; Mylc1v; Myosin alkali light chain 1, ventricular; Myosin alkali light chain 1, ventricular/slow skeletal muscle isoform; Myosin light chain 1, slow-twitch muscle B/ventricular isoform; myosin light chain 3; Myosin light chain 3, alkali, cardiac ventricles; myosin light chain, alkali, cardiac ventricles; myosin, light chain 3, alkali; ventricular, skeletal, slow; myosin, light polypeptide 3; myosin, light polypeptide 3, alkali; ventricular, skeletal, slow; rVMLC1; slow skeletal; slow skeletal ventricular myosin alkali light chain 3; ventricular; ventricular myosin alkali light chain; Ventricular myosin light chain 1; ventricular, skeletal, slow; ventricular/slow twitch myosin alkali light chain; VLC1; VLCl | |
| MYL3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MYL3 (aa 5-69) Control Fragment | |
| RUO | |
| MYL3 | |
| Unconjugated | |
| Recombinant | |
| KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |