missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MYH9 (aa 1165-1303) Control Fragment Recombinant Protein

Catalog No. RP100523
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100523 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100523 Supplier Invitrogen™ Supplier No. RP100523

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81960 (PA5-81960. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MYH9 gene, located on chromosome 22q12.3, encodes the heavy chain of non-muscle myosin IIA (NMHC IIA), a critical component of the actin cytoskeleton that plays essential roles in various cellular processes. Structurally, the MYH9 gene spans over 106 kilobases and includes 41 exons that translate into a protein of 1,960 amino acids. This protein is a part of a hexameric complex, which includes two heavy chains, two regulatory light chains, and two essential light chains. The NMHC IIA protein interacts with actin filaments and is involved in cellular activities such as cell migration, adhesion, division, and maintenance of cell shape. Functionally, mutations in MYH9 can result in a spectrum of autosomal dominant disorders collectively known as MYH9-related diseases (MYH9-RD), which include conditions such as May-Hegglin anomaly, Fechtner syndrome, and Epstein syndrome. These disorders are primarily characterized by macrothrombocytopenia (abnormally large platelets) and may lead to other complications such as hearing loss, renal failure, and cataracts later in life. MYH9 is also crucial in hematopoiesis, where its proper function is necessary for the survival and maintenance of hematopoietic stem and progenitor cells (HSPCs). Loss of MYH9 function disrupts normal hematopoiesis, leading to severe blood cell deficiencies and bone marrow failure.

Specifications

Accession Number P35579
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4627
Name Human MYH9 (aa 1165-1303) Control Fragment
Quantity 100 μL
Gene Alias BDPLT6; Cellular myosin heavy chain, type A; DFNA17; epsts; fi22c04; fj85e11; flectin; Fltn; FTNS; KLG/PTK7; LOC100911597; LOW QUALITY PROTEIN: myosin-9; MGC104539; MHA; Myh9; myh9.L; myh9a; myh9l2; Myhn1; Myhn-1; myosin; Myosin Heavy Chain 2 A; myosin heavy chain 9; myosin heavy chain IX; myosin heavy chain, non-muscle IIa; myosin IIA; myosin, heavy chain 9, non-muscle; myosin, heavy chain 9, non-muscle L homeolog; myosin, heavy chain 9, non-muscle, like-2; myosin, heavy chain 9 A, non-muscle; myosin, heavy polypeptide 9, non-muscle; myosin, heavy polypeptide 9 A, non-muscle; myosin-2 A; myosin9; Myosin-9; myosin-9; myosin-9 A; myosin-9-like; NMHC II-A; NMHC-II A; NMHCIIA; NMHC-II-A; NMMHC IIA; NMMHC II-a; nmmhca; NMMHC-A; NMMHC-IIA; non-muscle myosin heavy chain 9; non-muscle myosin heavy chain A; non-muscle myosin heavy chain II A; non-muscle myosin heavy chain IIa; nonmuscle myosin heavy chain II-A; non-muscle myosin heavy polypeptide 9; nonmuscle myosin II heavy chain A; TU72.6; Unknown (protein for IMAGE:7151033); Unknown (protein for IMAGE:7177375); Unknown (protein for IMAGE:7268224); wu:fi22c04; wu:fi22c04 protein; wu:fj85e11; XELAEV_18023533mg; zgc:162029; zgc:66164; zNMHC-IIA
Common Name MYH9
Gene Symbol MYH9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence REQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less