missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MTX3 (aa 241-306) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107125
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66452 (PA5-66452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Could function in transport of proteins into the mitochondrion.Specifications
| Q5HYI7 | |
| Blocking Assay, Control | |
| 345778 | |
| 100 μL | |
| 4930470O13Rik; AA409304; AI853833; AU067765; EG624619; Gm1194; Gm6514; metaxin 3; metaxin-3; mtx3; pleckstrin homology domain containing, family M (with RUN domain) member 2; zgc:109718; zMTX3 | |
| MTX3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MTX3 (aa 241-306) Control Fragment | |
| RUO | |
| MTX3 | |
| Unconjugated | |
| Recombinant | |
| FRLSLGGISPAGQETVDANLQKLTQLVNKESNLIEKMDDNLRQSPQLPPRKLPTLKLTPAEEENNS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |