missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MTMR11 (aa 243-334) Control Fragment Recombinant Protein

Catalog No. RP109308
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109308 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109308 Supplier Invitrogen™ Supplier No. RP109308

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140256 (PA5-140256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MTMR11 is a protein coding gene.

Specifications

Accession Number A4FU01
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10903
Name Human MTMR11 (aa 243-334) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cisplatin resistance associated; cisplatin resistance-associated protein; CRA; hCRA; Inactive phosphatidylinositol 3-phosphatase 11; MTMR11; myotubularin related protein 11; myotubularin-related protein 11
Common Name MTMR11
Gene Symbol MTMR11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less