missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108519

Invitrogen™ Human MSH2 (aa 37-120) Control Fragment Recombinant Protein

Catalog No. RP108519
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108519 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108519 Supplier Invitrogen™ Supplier No. RP108519

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in neurogenesis and neuronal migration. Necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Necessary for cytokinesis and cell proliferation.

Specifications

Accession Number P43246
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4436
Name Human MSH2 (aa 37-120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI788990; COCA1; DNA mismatch repair protein MSH2; FCC1; hMSH2; HNPCC; HNPCC1; LCFS2; mismatch repair ATPase MSH2; mismatch repair protein; MSH2; Msh2p; mutS homolog 2; mutS homolog 2 (E. coli); mutS homolog 2, colon cancer, nonpolyposis type 1; mutS protein homolog 2; O0935; PMS5; YOL090W
Common Name MSH2
Gene Symbol Msh2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less