missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MRPS30 (aa 130-221) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92027
Description
Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53844 (PA5-53844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Mitochondrial ribosomes consist of a large 39S subunit and a small 28S subunit, both of which are comprised of multiple mitochondrial ribosomal proteins (MRPs) that are encoded by nuclear genes and are essential for protein synthesis within mitochondria. MRP-S30 (mitochondrial ribosomal protein S30), also known as PDCD9 (programmed cell death protein 9), is a 439 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 28S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. MRP-S30 is expressed in kidney, liver, heart and skeletal muscle. The gene encoding MRP-S30 maps to human chromosome 5, which contains 181 million base pairs and comprises nearly 6% of the human genome. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome.Specifications
| Q9NP92 | |
| Blocking Assay, Control | |
| 10884 | |
| 100 μL | |
| 2610020A16Rik; 28 S ribosomal protein S30, mitochondrial; 39 S ribosomal protein S30, mitochondrial; AA968347; BM-047; Mitochondrial large ribosomal subunit protein mL65; Mitochondrial large ribosomal subunit protein mS30; mitochondrial ribosomal protein S30; MRP S30; Mrps30; MRP-S30; PAP; PDCD9; programmed cell death 9; Programmed cell death protein 9; S30mt | |
| Mrps30 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MRPS30 (aa 130-221) Control Fragment | |
| RUO | |
| MRPS30 | |
| Unconjugated | |
| Recombinant | |
| EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGH | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |