missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MRPL18 (aa 98-163) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94671
Description
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55974 (PA5-55974. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L18P ribosomal protein family. Three polymorphic sites exist in this gene, one of which is three nt in length which causes an extra aa near the N-terminus.Specifications
| Q9H0U6 | |
| Blocking Assay, Control | |
| 29074 | |
| 100 μL | |
| 1010001C05Rik; 39 S ribosomal protein L18, mitochondrial; C79879; HSPC071; L18mt; Mitochondrial large ribosomal subunit protein uL18m; mitochondrial ribosomal protein L18; Mrpl18; MRP-L18 | |
| Mrpl18 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MRPL18 (aa 98-163) Control Fragment | |
| RUO | |
| MRPL18 | |
| Unconjugated | |
| Recombinant | |
| NGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |