missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109844

Invitrogen™ Human MOGAT1 (aa 120-182) Control Fragment Recombinant Protein

Catalog No. RP109844
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109844 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109844 Supplier Invitrogen™ Supplier No. RP109844

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine.

Specifications

Accession Number Q96PD6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 116255
Name Human MOGAT1 (aa 120-182) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 0610030A14Rik; 1110064N14Rik; 2-acylglycerol O-acyltransferase 1; acyl CoA:monoacylglycerol acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; DC2; DGAT2L; Dgat2l1; Diacylglycerol acyltransferase 2-like protein 1; diacylglycerol O-acyltransferase 2 like 1; diacylglycerol O-acyltransferase 2-like 1; diacylglycerol O-acyltransferase candidate 2; hDC2; LOW QUALITY PROTEIN: 2-acylglycerol O-acyltransferase 1; mDC2; MGAT1; Mogat1; Monoacylglycerol O-acyltransferase 1; putative monoacylglycerol acyltransferase 1; WI1-2612I11.1
Common Name MOGAT1
Gene Symbol MOGAT1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less