missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96916

Invitrogen™ Human MOCS2 (aa 6-73) Control Fragment Recombinant Protein

Catalog No. RP96916
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96916 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96916 Supplier Invitrogen™ Supplier No. RP96916
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58055 (PA5-58055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits.

Specifications

Accession Number O96007, O96033
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4338
Name Human MOCS2 (aa 6-73) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI415403; HAMAP-Rule:MF_03052}; MCBPE; MOCO1; MOCO1-A; MOCO1-B; MOCODB; Mocs2; mocs2 {ECO:0000255; MOCS2A; MOCS2B; MOCS2B {ECO:0000255; molybdenum cofactor; molybdenum cofactor biosynthesis protein E; molybdenum cofactor synthesis 2; molybdenum cofactor synthesis protein 2 large subunit; molybdenum cofactor synthesis protein 2 large subunit {ECO:0000255; Molybdenum cofactor synthesis protein 2 small subunit; Molybdenum cofactor synthesis protein 2 A; Molybdenum cofactor synthesis protein 2 B; molybdenum cofactor synthesis protein 2 B {ECO:0000255; molybdopterin synthase catalytic subunit; molybdopterin synthase catalytic subunit {ECO:0000255; molybdopterin synthase catalytic subunit; molybdopterin synthase sulfur carrier subunit; molybdopterin synthase small and large subunit; molybdopterin synthase sulfur carrier subunit; Molybdopterin-synthase large subunit; Molybdopterin-synthase small subunit; MPT synthase large subunit; MPTS; Sulfur carrier protein MOCS2A
Common Name MOCS2
Gene Symbol MOCS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less