missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88652

Invitrogen™ Human MMP3 (aa 236-363) Control Fragment Recombinant Protein

Catalog No. RP88652
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88652 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88652 Supplier Invitrogen™ Supplier No. RP88652
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82318 (PA5-82318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MMP3 (stromelysin-1) belongs to the peptidase M10A subfamily. It is secreted in its pro-protein form, and is activated by extracellular proteinase cleavage. MMP3 is capable of binding to zinc and calcium ions, and has metallo-endopeptidase activity. The active enzyme degrades collagen, gelatin, fibronectin, and laminin. It is involved in normal cellular processes such as wound repair and tissue remodeling. Mutations in the gene can result in coronary heart disease 6.

Specifications

Accession Number P08254
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4314
Name Human MMP3 (aa 236-363) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CHDS6; EC 3.4.24.17; EMS-2; matrix metallo protease; matrix metallopeptidase 3; matrix metallopeptidase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3; matrix metalloproteinase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3 precursor; matrix metalloproteinase-3; metalloproteinase 3 receptor; MMP; MMP10; MMP3; MMP-3; MMP-3 protein; MMPs; progelatinase; proteoglycanase; SL-1; SLN1; SLN-1; STMY; STMY1; Str1; STR-1; stromelysin; stromelysin 1; Stromelysin1; stromelysin-1; Transin1; Transin-1
Common Name MMP3
Gene Symbol MMP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less