missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88846

Invitrogen™ Human MMEL1 (aa 179-311) Control Fragment Recombinant Protein

Catalog No. RP88846
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88846 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88846 Supplier Invitrogen™ Supplier No. RP88846

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82339 (PA5-82339. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MMEL1 is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis. MMEL1 is a type II transmembrane protein and is thought to be expressed as a secreted protein. The protein encoded by this gene is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis. This protein is a type II transmembrane protein and is thought to be expressed as a secreted protein. This gene is expressed mainly in testis with weak expression in the brain, kidney, and heart.

Specifications

Accession Number Q495T6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79258
Name Human MMEL1 (aa 179-311) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EC 3.4.24; EC 3.4.24.11; mel transforming oncogene-like 1; Mell1; membrane metalloendopeptidase like 1; Membrane metallo-endopeptidase-like 1; Membrane metallo-endopeptidase-like 1, soluble form; Membrane metallo-endopeptidase-like 2; MGC119454; MGC119455; MGC119456; Mmel1; MMEL2; NEP2; NEP2(m); NEP2; NEPII; NEPIIMGC119456; NEPLP; NEPLP alpha; NEPLP beta; NEPLP gamma; neprilysin 2; neprilysin II; Neprilysin-2; Neprilysin-2 secreted; Neprilysin-like 1; neprilysin-like peptidase; Nl1; NL-1; NL2; NL2NL1; SEP; Soluble secreted endopeptidase; zinc metallopeptidase
Common Name MMEL1
Gene Symbol MMEL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVIEKRGSQPLLDILEVVGGWPVAMDRWNETVGLEWELERQLALMNSQFNRRVLIDLFIWNDDQNSSRHIIYIDQPTLGMPSREYYFNGGSNRKVREAYLQFMVSVATLLREDANLPRDSCLVQEDMVQVLEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less