Learn More
Invitrogen™ Human MKP2 (aa 333-386) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107115
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66440 (PA5-66440, PA5-145156 (PA5-145156. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DUSP4 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP4 inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus.Specifications
| Q13115 | |
| Blocking Assay, Control | |
| 1846 | |
| 100 μL | |
| 2700078F24Rik; AI844617; BB104621; dual specificity phosphatase 4; dual specificity protein phosphatase 4; Dual specificity protein phosphatase hVH2; DUSP 4; DUSP4; DUSP-4; E130306H24Rik; HVH2; MAP kinase phosphatase 2; mitogen-activated protein kinase phosphatase 2; MKP II; Mkp2; Mkp-2; MKPII; serine/threonine specific protein phosphatase; TYP; VH1 homologous phosphatase 2; VH2 | |
| DUSP4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MKP2 (aa 333-386) Control Fragment | |
| RUO | |
| MKP2 | |
| Unconjugated | |
| Recombinant | |
| QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |