missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96161

Invitrogen™ Human MITD1 (aa 1-81) Control Fragment Recombinant Protein

Catalog No. RP96161
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96161 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96161 Supplier Invitrogen™ Supplier No. RP96161

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57549 (PA5-57549. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MITD1 may play a role in endosomal protein transport.

Specifications

Accession Number Q8WV92
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 129531
Name Human MITD1 (aa 1-81) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500032H18Rik; hypothetical protein MGC56159; microtubule interacting and trafficking domain containing 1; MIT domain-containing protein 1; MIT, microtubule interacting and transport, domain containing 1; Mitd1; RGD1307700; zgc:56159
Common Name MITD1
Gene Symbol MITD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less