missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95354

Invitrogen™ Human MIOX (aa 136-209) Control Fragment Recombinant Protein

Catalog No. RP95354
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95354 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95354 Supplier Invitrogen™ Supplier No. RP95354
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58840 (PA5-58840. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MIOX (Myo-Inositol Oxygenase) is a Protein Coding gene. Among its related pathways are superpathway of inositol phosphate compounds and Porphyrin and chlorophyll metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on NAD(P)H.

Specifications

Accession Number Q9UGB7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55586
Name Human MIOX (aa 136-209) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610009I10Rik; AI314022; aldehyde reductase (aldose reductase) like 6; aldehyde reductase (aldose reductase)-like 6; aldehyde reductase 6, renal; aldehyde reductase-like 6; Aldrl6; C85427; Inositol oxygenase; kidney-specific protein 32; KSP32; MI oxygenase; Miox; Myo-inositol oxygenase; renal-specific oxido-reducatse; renal-specific oxidoreductase; renal-specific oxido-reductase; Rsor
Common Name MIOX
Gene Symbol MIOX
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less