missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MIB1 (aa 256-362) Control Fragment Recombinant Protein

Catalog No. RP92400
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92400 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92400 Supplier Invitrogen™ Supplier No. RP92400

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53924. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MIB is an E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. This protein positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. MIB probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis.

Specifications

Accession Number Q86YT6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 57534
Name Human MIB1 (aa 256-362) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias DAPK-interacting protein 1; DAPK-interacting protein-1; DIP1; DIP-1; E3 ubiquitin-protein ligase MIB1; E430019M12Rik; KIAA1323; LVNC7; MIB; MIB1; Mind bomb homolog 1; mind bomb-1; mindbomb E3 ubiquitin protein ligase 1; mindbomb homolog 1; mindbomb homolog 1 (Drosophila); mKIAA1323; RING-type E3 ubiquitin transferase MIB1; skeletrophin; ubiquitin ligase mind bomb; zinc finger ZZ type with ankyrin repeat domain protein 2; ZZANK2; ZZZ6
Common Name MIB1
Gene Symbol MIB1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less