missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MGAM2 (aa 47-121) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100003
Description
Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63162 (PA5-63162. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
MGAM2 (Maltase-Glucoamylase 2 (Putative)) is a Protein Coding gene. Among its related pathways are Metabolism and Galactose metabolism. Gene Ontology (GO) annotations related to this gene include carbohydrate binding and glucan 1,4-alpha-glucosidase activity. An important paralog of this gene is MGAM. [GeneCards]Specifications
| Q2M2H8 | |
| Blocking Assay, Control | |
| 93432 | |
| 100 μL | |
| Glucan 1,4-alpha-glucosidase; Glucoamylase; maltase-glucoamylase (alpha-glucosidase); Maltase-glucoamylase (alpha-glucosidase) pseudogene; maltase-glucoamylase 2 (putative); MGAM2; Probable maltase-glucoamylase 2; putative maltase-glucoamylase-like protein FLJ16351 | |
| MGAM2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MGAM2 (aa 47-121) Control Fragment | |
| RUO | |
| MGAM2 | |
| Unconjugated | |
| Recombinant | |
| PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |