missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104191

Invitrogen™ Human METTL17 (aa 323-440) Control Fragment Recombinant Protein

Catalog No. RP104191
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104191 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104191 Supplier Invitrogen™ Supplier No. RP104191

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63776 (PA5-63776. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

M11D1 may be a component of the mitochondrial small ribosomal subunit.

Specifications

Accession Number Q9H7H0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64745
Name Human METTL17 (aa 323-440) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias False p73 target gene protein; methyltransferase 11 domain containing 1; methyltransferase 11 domain-containing protein 1; methyltransferase like 17; methyltransferase-like protein 17, mitochondrial; METT11D1; METTL17; Protein RSM22 homolog, mitochondrial
Common Name METTL17
Gene Symbol METTL17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less